PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010054m
Common NameEUTSA_v10010054mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MYB
Protein Properties Length: 1651aa    MW: 181285 Da    PI: 6.6852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010054mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.4e-11869910346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e +++  +++G++ +k+Ia+++   +t  +c+++++k
  Thhalv10010054m 869 PWTSEEKETFLNMLAMHGKD-FKKIASYLA-QKTTADCIDYYYK 910
                      8*****************99.*********.9**********98 PP

2Myb_DNA-binding23.21.6e-0710841125447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I+r +  +R+  qc+ ++ k+
  Thhalv10010054m 1084 WTDDERSAFIQGFSLFGKN-FASISRFVR-TRSQDQCRVFFSKV 1125
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.92E-14852913IPR009057Homeodomain-like
PROSITE profilePS5129315.914865916IPR017884SANT domain
SMARTSM007177.0E-10866914IPR001005SANT/Myb domain
PfamPF002494.5E-9868910IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-7869915IPR009057Homeodomain-like
CDDcd001673.60E-8869911No hitNo description
PROSITE profilePS5129311.9510791130IPR017884SANT domain
SMARTSM007173.0E-610801128IPR001005SANT/Myb domain
SuperFamilySSF466897.65E-910831130IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-410831125IPR009057Homeodomain-like
CDDcd001672.45E-510841125No hitNo description
PfamPF002495.7E-610841124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1651 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHE RPEASFDSAF RWRDSPTNPS SHHVPREFSR WGSGDFRRPS  60
CHGKQGGRHQ FVEETSHGYT SSRSSARMFD NDYYRPSAPR GDWRYTRNCR DDRVSFSQKD  120
WKCNTWEMSN GSSRGFERPC GIRNGRRSVD ERPPHASDTH TNVVNSWDPA NSTPHPDIEL  180
CTPLRTLKFK NELKFSDQRL SLPSDPLSDC VSSFERPSSE NNYGNKAYSP AKQCNDLVHA  240
RRLANDNSLD PPTLNAELEG TWEQLHLKDP QANRSHGSDL DGARKCDKES SLGAIGKLPA  300
WTGSGSFASQ SSSFSHSGSL KSLGAVDSSD RKNEVLLKIV AVTQSSSGDA TACATTTLLT  360
DEMSSRKKQR LGWGEGLAKY EKKKVDVNTN EDGTTLLENS TEELHSLNKN IVDKSPTAAI  420
VPEYGSPTTP SSVACSSSPG FADKSSAKAA ITASDVNNLC RSPSPVSSTH LERFPINIEE  480
IDNISMERFG CLLNELLGTD DSGTGDSSSV QLTSMNRLLA WKGDILKAVE ITESEIDLLE  540
NKHKTLMLEG GRQCRVVGSS SRLCEGDENV ANEQEASCIL GPKAAASSVS ETLVRDPVHQ  600
AVLAKVPVDV FEDCPGEVKS LSQSLATVES SEDMLPIPSM KAAASSKEIN RSAFANQETI  660
ELSFADDSMA SNEDVLCAKL LSSNKKYASE SSEVFNELLP RDFSSFDGLR FPGICQRQFD  720
SHVNEKIADR IELLRAREKI LLLQYKAFQL AWKKDLRQLA FSKYQPKSNK KTELYPNAKN  780
SGYLKLPQPA RLRLSSSAPR KDSVASTTEL VSYMEKLLQG TCLKPFRDML RMPAMILDEK  840
ERAMSRFISS NGLIEDPCDV EKERTMINPW TSEEKETFLN MLAMHGKDFK KIASYLAQKT  900
TADCIDYYYK NHKSDCFGKI KKQRAYGKEG KHTYMLAPRK KWKRDMGAAS LDILGAVSII  960
AANAGKVAST RQIPSKRITL RGCSSSNSLH HDGNNSEGCS YSFDFPRKRT LGENVLDVGP  1020
LSSEQINSCL RTSVNSSERC IDHLKFDHVV KKPRISHTTH NENSNEEDDS CSEESCGETG  1080
PIHWTDDERS AFIQGFSLFG KNFASISRFV RTRSQDQCRV FFSKVRKCLG LECIQSGSGN  1140
ISTSASVDNA NEGGGSDLED PCAMESNSGI CSNGVSAKMG LNSPTSPFNM NQEGTNHSDT  1200
ANMKADLSRS EQENGLTYLR RKDDTSLVNK ASINGDFPGV VSEPCRDSVD INTVESQCQD  1260
AGKIKSNDLL SMEIDEGNLT PVAVSSDPLY CGSSVLSNII VETPTESSRK GSGGQGAALP  1320
KQSSKNQDGV MQAANKTRNS GLEAEAAPSS FSYPECLHHV PIEVSTDDLV GVSVPQGNPN  1380
CQTESELPNA LAGQVVQTNN LGWQFSKVNL DLDGKIRALG HVNPVQNGQL RATNAEYSQI  1440
AQIFTQDPSR ISRSKSDLIV KTQRTGEGFS LNKCTSSGTK PLTVYHKDES SGHSRSHSFS  1500
LCDTERLDMN GDVKLFGTVL TADENRSKQK HNPGGSIRSS STLSRDQDTR HQYINQQHLQ  1560
NVPITSYGFW DGNRIQTGLT SLPESAKLLA SCPEAFATHL KQQVVSTKEI QLDVNGILSF  1620
GKHIEDRAEI SSGKDEGNIG GVNGVAEAAT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D7e-17827917493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C7e-17827917493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403821.10.0hypothetical protein EUTSA_v10010054mg
TrEMBLV4LND50.0V4LND5_EUTSA; Uncharacterized protein
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein